• 23.155.76.145
  • United States of America flag
IP Address: 23.155.76.145
ISP: Keshia Services Inc.
Connection Speed: (DSL) Broadband/Cable/Fiber
City: Kalamazoo
Country: United States of America
State: Michigan
Latitude: 42.29171
Longitude: -85.58723
Time Zone: UTC -04:00
Local Time: 27 Aug, 2026 03:46 AM
Proxy: No
Proxy Provider: -
Fraud Score: 0
Address Type: Unicast
District: Kalamazoo County
ZIP Code: 49001
Area Code: 269
IDD Code: 1
Weather Station: Kalamazoo (USMI0442)
Usage Type: (COM) Commercial
Domain Name: keshiaservicesfinancialsystems.net [WHOIS keshiaservicesfinancialsystems.net]
Mobile MNC: -
Mobile MCC: -
Mobile Brand: -
Elevation: 239 meters
Atmospheric Pressure: 985 hPa
ASN Number: 401880
ASN Name: Keshia Services Inc.
Category: (IAB24) Uncategorized
Hosted Domain: -
User Agent: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; [email protected])
Referrer:
Device: unknown
Operating System: unknown
Architecture: 32 bits
Browser: DefaultProperties
Country: United States of America
Capital: Washington
Continent: North America
Population: 310,232,863
Area: 9,629,091 km²
Currency: (USD) Dollar
Top Level Domain: .us

Is the above data incorrect? Help us improve our database accuracy. wrong data.

The IP geolocation information on ipaddress.my is sourced from the IP2Location.io IP Geolocation API . Sign up for free API access now.

Get
$ curl "https://api.ip2location.io/?key={YOUR_API_KEY}&ip=23.155.76.145"
Response
{
    "ip": "23.155.76.145",
    "country_code": "US",
    "country_name": "United States of America",
    "region_name": "Michigan",
    "district": "Kalamazoo County",
    "city_name": "Kalamazoo",
    "latitude": 42.29171,
    "longitude": -85.58723,
    "zip_code": "49001",
    "time_zone": "-04:00",
    "asn": "401880",
    "as": "Keshia Services Inc.",
    "as_info": {
        "as_number": "401880",
        "as_name": "Keshia Services Inc.",
        "as_domain": "-",
        "as_usage_type": "-",
        "as_cidr": "23.155.76.0\/24"
    },
    "isp": "Keshia Services Inc.",
    "domain": "keshiaservicesfinancialsystems.net",
    "net_speed": "DSL",
    "idd_code": "1",
    "area_code": "269",
    "weather_station_code": "USMI0442",
    "weather_station_name": "Kalamazoo",
    "mcc": "-",
    "mnc": "-",
    "mobile_brand": "-",
    "elevation": 239,
    "usage_type": "COM",
    "address_type": "Unicast",
    "ads_category": "IAB24",
    "ads_category_name": "Uncategorized",
    "continent": {
        "name": "North America",
        "code": "NA",
        "hemisphere": [
            "north",
            "west"
        ],
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "country": {
        "name": "United States of America",
        "alpha3_code": "USA",
        "numeric_code": 840,
        "demonym": "Americans",
        "flag": "https:\/\/cdn.ip2location.io\/assets\/img\/flags\/us.png",
        "capital": "Washington, D.C.",
        "total_area": 9826675,
        "population": 339665118,
        "currency": {
            "code": "USD",
            "name": "United States Dollar",
            "symbol": "$"
        },
        "language": {
            "code": "EN",
            "name": "English"
        },
        "tld": "us",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "region": {
        "name": "Michigan",
        "code": "US-MI",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "city": {
        "name": "Kalamazoo",
        "translation": {
            "lang": null,
            "value": null
        }
    },
    "time_zone_info": {
        "olson": "America\/Detroit",
        "current_time": "2026-08-27T03:46:21-04:00",
        "gmt_offset": -14400,
        "is_dst": true,
        "abbreviation": "EST",
        "dst_start_date": "2026-03-08",
        "dst_end_date": "2026-11-01",
        "sunrise": "07:03",
        "sunset": "20:27"
    },
    "geotargeting": {
        "metro": "563"
    },
    "is_proxy": false,
    "fraud_score": 0,
    "proxy": {
        "last_seen": 0,
        "proxy_type": "-",
        "threat": "-",
        "provider": "-",
        "is_vpn": false,
        "is_tor": false,
        "is_data_center": false,
        "is_public_proxy": false,
        "is_web_proxy": false,
        "is_web_crawler": false,
        "is_ai_crawler": false,
        "is_residential_proxy": false,
        "is_consumer_privacy_network": false,
        "is_enterprise_private_network": false,
        "is_spammer": false,
        "is_scanner": false,
        "is_botnet": false,
        "is_bogon": false
    }
}
IP Geolocation Database

IP Geolocation Database

Get detailed location info from IP addresses using downloadable databases.

IP Geolocation API

Real-time IP Geolocation API

Instantly retrieve IP geolocation data with a fast and reliable API.

Domain WHOIS API

Domain WHOIS Lookup API

Access domain owner and registrar info in real-time via API.

Free IP Geolocation Database

IP Geolocation LITE

Download a free IP geolocation database with essential location data.

Unleash The Power of IP Intelligence

Retrieve comprehensive IP geolocation information by IP address lookup.

Get Free Demo Account Today